DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33831 and zgc:110216

DIOPT Version :9

Sequence 1:NP_001027329.1 Gene:His1:CG33831 / 3772075 FlyBaseID:FBgn0053831 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001013495.2 Gene:zgc:110216 / 541350 ZFINID:ZDB-GENE-050320-42 Length:201 Species:Danio rerio


Alignment Length:229 Identity:94/229 - (41%)
Similarity:118/229 - (51%) Gaps:44/229 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGGSSLLAIKKYITA- 77
            |||||...||        .|.:|.|||.     |..:.::..::...|||.|.||.|:||.::| 
Zfish     7 AAPPAKAPKK--------KAASKPKKAG-----PNVRDLIVKTVTASKERHGVSLAALKKALSAG 58

  Fly    78 TYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKAKSKVLSAEKK--V 140
            .|  |.:|....:|..:|:.|.||.|:||||.||||||||:   ||:.:||.|    .|.||  |
Zfish    59 GY--DVEKNNSRVKIAVKALVTNGTLVQTKGTGASGSFKLN---KKQAEPKKK----PAAKKTAV 114

  Fly   141 QSKKVASKKIGVSS-----KKTAVGAADKKP-KAKKAVATKKTAENKKTEKAKAKDAKKTGIIKS 199
            ::||.|:||....|     |.||...|.|.| ||||..|.||..::.|..| |...|||      
Zfish   115 KAKKPAAKKPAAKSPKKVKKPTAAKKATKSPKKAKKPAAAKKATKSPKKAK-KPAAAKK------ 172

  Fly   200 KPAATKAKVTAAKPKAVVAKASKAKPAVSAKPKK 233
               |||:....||||.|..||:|.|   .|.|||
Zfish   173 ---ATKSPKKVAKPKTVKPKAAKPK---KAAPKK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33831NP_001027329.1 Linker_histone 46..118 CDD:278939 31/72 (43%)
zgc:110216NP_001013495.2 Linker_histone 27..97 CDD:278939 31/71 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I11086
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I4847
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2142
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.990

Return to query results.
Submit another query.