DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheB74a and CheB38c

DIOPT Version :9

Sequence 1:NP_001027134.1 Gene:CheB74a / 3772073 FlyBaseID:FBgn0261294 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_610061.2 Gene:CheB38c / 35346 FlyBaseID:FBgn0032888 Length:198 Species:Drosophila melanogaster


Alignment Length:194 Identity:67/194 - (34%)
Similarity:117/194 - (60%) Gaps:3/194 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ILIFLTAAQPSIGGYFEYVLDDESVFSECFNTPPGYANVSGLFDVSTVNFEMGPEGVHIDGHVTS 75
            :||.:..:...:...:..:::|..:::.|.:.|||...::..||||.:..||..||:|:.|::|:
  Fly     5 LLILILGSTDILATDYILLVEDPDIYTPCTDGPPGSVGLNEAFDVSEMQVEMDEEGIHVSGNITT 69

  Fly    76 TWDIQPTDRIEGRLNVVHMDRGTWQPTVLNMVCKDFCKTFLDPNQYWYNVFPKHIINKDEARQKC 140
            .|.:.||.||..|::|:|.:||.|:|||.|.:..|||....:||.:||..:.|:..|::|.::||
  Fly    70 RWSLPPTYRISARMSVLHFNRGNWEPTVFNTLTPDFCDAMFNPNLFWYKYWFKNFENREEIQEKC 134

  Fly   141 LNYKGTVYFVEPYTL--QMHFGLGLTLPSGRNRMVINLVAIDENNVTRPNGICFEVKGDFFKIE 202
            |..:|||....|:.:  :::..||.|| .||.::|....|.:|.:..:|:.:|||:.||..||:
  Fly   135 LATQGTVLVYNPFVVVPRLNNVLGPTL-KGRYKVVFLFEAFNEQDERQPSSVCFEITGDAEKIK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheB74aNP_001027134.1 DM11 26..186 CDD:128920 57/161 (35%)
CheB38cNP_610061.2 DM11 18..181 CDD:128920 57/163 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448917
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003852
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.