DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheB74a and CheB53a

DIOPT Version :9

Sequence 1:NP_001027134.1 Gene:CheB74a / 3772073 FlyBaseID:FBgn0261294 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001014530.1 Gene:CheB53a / 3346205 FlyBaseID:FBgn0261292 Length:226 Species:Drosophila melanogaster


Alignment Length:193 Identity:73/193 - (37%)
Similarity:124/193 - (64%) Gaps:0/193 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LCQILIFLTAAQPSIGGYFEYVLDDESVFSECFNTPPGYANVSGLFDVSTVNFEMGPEGVHIDGH 72
            :.::::.|.....|:...:|:.::|||::|:|.:.|||..|:|||||::.....:..:|:.:.|:
  Fly     1 MLELILILNVVHLSLQISYEFEIEDESIYSDCSDVPPGTLNISGLFDLTNYTTTITADGLSVSGN 65

  Fly    73 VTSTWDIQPTDRIEGRLNVVHMDRGTWQPTVLNMVCKDFCKTFLDPNQYWYNVFPKHIINKDEAR 137
            :||.::.|||||||...|::..|||.||||.|||:.:|||....|..|.||..:..|::|:||.:
  Fly    66 MTSVFNAQPTDRIELTGNLLFFDRGAWQPTTLNMMVRDFCAVMYDKKQLWYTDWSSHVVNRDEIK 130

  Fly   138 QKCLNYKGTVYFVEPYTLQMHFGLGLTLPSGRNRMVINLVAIDENNVTRPNGICFEVKGDFFK 200
            ..|:...||::.:|.|.:::.||.|:.|.:||..:.:.:.|.|:....|||.:|:||||:|:|
  Fly   131 DNCIKVPGTLFLIESYNMKLVFGSGIPLGTGRYSIRVQVFAYDQKGKKRPNNVCYEVKGNFYK 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheB74aNP_001027134.1 DM11 26..186 CDD:128920 61/159 (38%)
CheB53aNP_001014530.1 DM11 18..179 CDD:128920 61/160 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448890
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003852
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.