DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mus201 and zgc:110269

DIOPT Version :9

Sequence 1:NP_001027230.1 Gene:mus201 / 3772069 FlyBaseID:FBgn0002887 Length:1236 Species:Drosophila melanogaster
Sequence 2:NP_001017611.2 Gene:zgc:110269 / 550274 ZFINID:ZDB-GENE-050417-81 Length:350 Species:Danio rerio


Alignment Length:319 Identity:69/319 - (21%)
Similarity:124/319 - (38%) Gaps:73/319 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   836 QERKELEIERNRQDRMGMSISQ------RMSIDCQELLRLFGIPYIVAPMEAEAQCAFLNATDLT 894
            |:|..||   .|....|.|.||      ..:.:|..||.|.|:|.|.||.||||.||.|......
Zfish    83 QKRAVLE---KRAQSTGWSSSQSPNTGSAFNQECLRLLHLMGVPCIKAPGEAEALCAHLAKIGTV 144

  Fly   895 HGTITDDSDIWLFGGRTVYKNFFA-QNKHVMEFRAEQIEQTFNCNRGKLIQLACLVGSDYTTGIH 958
            :...::|.|...|||..:.:...| ::..:.|:...::.:.......:.:.|..|:|.||...|.
Zfish   145 NAVASEDMDTLAFGGTVLLRQLNAKRDSEITEYSLPKLLEALQLKYEEFVDLCILLGCDYCDKIG 209

  Fly   959 GIGAVTALEILASFSGQDANGPGICNQSVLQTLIKFRDWWQAHKCSNLPPGSSARLALRKKLKNI 1023
            |:|...||::             |.....::.:::.                     :.:|...|
Zfish   210 GLGPSRALKL-------------IKEHHTIEGVMEH---------------------VNRKTHPI 240

  Fly  1024 ELHEGFPSGAVVEAYLAPTIDDNRDAFSWGTPDVESIREFTRKSFGWTTSKTDDILMPVMKKINE 1088
            .|:..:.....: .:..|.|||  ...:|..||.|.:.:|..|.                |.:.|
Zfish   241 PLNWQYKDARKL-FFETPKIDD--PVLAWSEPDEEGLVQFLCKE----------------KPLKE 286

  Fly  1089 KKIQGSIRNYFTAKSALRVQQPHVSKRVQLAIDKMSGKIDETP-EKPKKVTRTRRAKAA 1146
            ::::|.::.:         ::..:.:|.|..::...|:..::. |.....||.|||::|
Zfish   287 ERVRGRMKKF---------REMLLKRRKQREVNMQMGQTRQSRLEDFFPATRKRRAESA 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mus201NP_001027230.1 rad2 1..1122 CDD:273166 61/292 (21%)
PIN_XPG 1..>121 CDD:189038
PIN_XPG <814..1084 CDD:189038 56/254 (22%)
H3TH_XPG 940..1045 CDD:188624 16/104 (15%)
zgc:110269NP_001017611.2 PTZ00217 1..346 CDD:240317 69/319 (22%)
N-domain 1..95 5/14 (36%)
PIN_SF 2..325 CDD:301351 63/306 (21%)
I-domain 110..223 34/125 (27%)
H3TH_FEN1-Euk 191..255 CDD:188627 14/98 (14%)
Interaction with PCNA. /evidence=ECO:0000250 317..325 1/7 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094524at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.