DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mus201 and GEN1

DIOPT Version :9

Sequence 1:NP_001027230.1 Gene:mus201 / 3772069 FlyBaseID:FBgn0002887 Length:1236 Species:Drosophila melanogaster
Sequence 2:NP_001123481.3 Gene:GEN1 / 348654 HGNCID:26881 Length:908 Species:Homo sapiens


Alignment Length:534 Identity:113/534 - (21%)
Similarity:200/534 - (37%) Gaps:164/534 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   826 ELQELATNLAQERKELEIERNRQDRMGMSISQR------MSI--DCQELLRLFGIPYIVAPMEAE 882
            |..:|..::..:|.:     :|....|.|.||:      .|:  :|..:|...|||::.|..|||
Human    77 EPPKLKADVISKRNQ-----SRYGSSGKSWSQKTGRSHFKSVLRECLHMLECLGIPWVQAAGEAE 136

  Fly   883 AQCAFLNATDLTHGTITDDSDIWLFGGRTVYKNFFAQNK--HVMEFRAEQIEQTFNCNRGKLIQL 945
            |.||:|||.....|.:|:|.|.:|:|.:|||:||....|  ||..:....|:.....:|..|:.|
Human   137 AMCAYLNAGGHVDGCLTNDGDTFLYGAQTVYRNFTMNTKDPHVDCYTMSSIKSKLGLDRDALVGL 201

  Fly   946 ACLVGSDY-TTGIHGIGAVTALEILASFSGQDANGPGICNQSVLQTLIKFRDWWQAHKCSNLP-- 1007
            |.|:|.|| ..|:.|:|...||:::....|          ||:||...:    |....|::.|  
Human   202 AILLGCDYLPKGVPGVGKEQALKLIQILKG----------QSLLQRFNR----WNETSCNSSPQL 252

  Fly  1008 --------------PGS-------SARLALRKK-----------------------LKNIELH-- 1026
                          |||       ..||....|                       |..:|.:  
Human   253 LVTKKLAHCSVCSHPGSPKDHERNGCRLCKSDKYCEPHDYEYCCPCEWHRTEHDRQLSEVENNIK 317

  Fly  1027 ------EGFPSGAVVEAYLAPTIDDNRD----AFSWGTPDVESIREFTRKSFGWTT--------- 1072
                  ||||...|::.:|.     |:|    ...:..||:...:.||.:...|..         
Human   318 KKACCCEGFPFHEVIQEFLL-----NKDKLVKVIRYQRPDLLLFQRFTLEKMEWPNHYACEKLLV 377

  Fly  1073 -------------SKTDDILMPVMKKINEKKIQGSIRNYFTAKSALRVQQP-HVSKRVQLAIDKM 1123
                         |:..:.|.|:  :|.:.:|:..:..:     .:..::| |.:..     ||.
Human   378 LLTHYDMIERKLGSRNSNQLQPI--RIVKTRIRNGVHCF-----EIEWEKPEHYAME-----DKQ 430

  Fly  1124 SGK-----IDET-------PE------KPKKVTRTRRAKAAPPTDDDLAIADVATK-----AARP 1165
            .|:     |:|.       ||      |.|...:.::.|...|.:::|...|....     ..:|
Human   431 HGEFALLTIEEESLFEAAYPEIVAVYQKQKLEIKGKKQKRIKPKENNLPEPDEVMSFQSHMTLKP 495

  Fly  1166 ------KRGKR---KAAPESVVLDGELPSTSQSIPKPEKCPRIPSSVEVIPQ-REKDLEQMRLNK 1220
                  |:..:   ..:|:..:....:.::..|:..|:..|.:.:..:.:.. |...::|:   |
Human   496 TCEIFHKQNSKLNSGISPDPTLPQESISASLNSLLLPKNTPCLNAQEQFMSSLRPLAIQQI---K 557

  Fly  1221 AKAAEILKNSAKAN 1234
            |.:..::..|::.|
Human   558 AVSKSLISESSQPN 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mus201NP_001027230.1 rad2 1..1122 CDD:273166 88/387 (23%)
PIN_XPG 1..>121 CDD:189038
PIN_XPG <814..1084 CDD:189038 84/348 (24%)
H3TH_XPG 940..1045 CDD:188624 34/159 (21%)
GEN1NP_001123481.3 PIN_GEN1 2..206 CDD:350217 44/133 (33%)
XPG-N domain. /evidence=ECO:0000269|PubMed:26682650 2..96 4/23 (17%)
XPG-I domain. /evidence=ECO:0000269|PubMed:26682650 122..208 34/85 (40%)
H3TH_GEN1 195..338 CDD:188625 35/161 (22%)
5'-3' exonuclease domain. /evidence=ECO:0000269|PubMed:26682650 208..384 36/194 (19%)
Chromodomain. /evidence=ECO:0000269|PubMed:26682650 390..464 16/85 (19%)
Chromo_2 398..458 CDD:376128 12/71 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094524at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.