DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mus201 and gen1

DIOPT Version :9

Sequence 1:NP_001027230.1 Gene:mus201 / 3772069 FlyBaseID:FBgn0002887 Length:1236 Species:Drosophila melanogaster
Sequence 2:XP_009298211.1 Gene:gen1 / 101884233 -ID:- Length:967 Species:Danio rerio


Alignment Length:445 Identity:97/445 - (21%)
Similarity:169/445 - (37%) Gaps:135/445 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   862 DCQELLRLFGIPYIVAPMEAEAQCAFLNATDLTHGTITDDSDIWLFGGRTVYKNFFAQNK--HVM 924
            :|.::|...|:|::.|..||||.||||::..|..|.||:|.|.:|:|.||||:||....|  .|.
Zfish   120 ECAQMLDCLGVPWVTAAGEAEAMCAFLDSQGLVDGCITNDGDAFLYGARTVYRNFNMTTKDPQVD 184

  Fly   925 EFRAEQIEQTFNCNRGKLIQLACLVGSDY-TTGIHGIGAVTALEILASFSGQDANGPGICNQSVL 988
            .:::.::::.....|..|:.||.|:|.|| ..||.|:|....|:::.|..|          |::|
Zfish   185 CYQSSRVQEELGLCRETLVGLAVLLGCDYIPKGIAGVGREQTLKLIHSLRG----------QTLL 239

  Fly   989 QTLIKFRDW-------------------------------------------------------- 997
            |   ||.:|                                                        
Zfish   240 Q---KFSEWSSGASGDSELQMKKVTHCLVCRHPGSAKAHERSGCVFCVSERFCSPQDYDSQCPCE 301

  Fly   998 WQAHKCSNLPPGSSARLALRKKLKNIELHEGFPSGAVVEAYLAPTIDDNRDAFSWGTPDVESIRE 1062
            |  |:...|...||....:||:..   ..|.||...::..:|. |.|....||....|::..::|
Zfish   302 W--HQTQALRQASSLENNIRKRTL---ASEHFPFTHIINEFLL-TKDKPVQAFRRRKPNLLLMQE 360

  Fly  1063 FTRKSFGWTTSKTDDILMPVM---KKINEKKIQGSIRNYFTAKSALRVQQPHVSKRV-------- 1116
            |..:...|....:.:.|:.:|   :.:|.:  .|  |:..|....:|:.:..|...|        
Zfish   361 FALEKMDWPKHYSSEKLLTLMTYTEMVNRR--LG--RDSHTHMQPIRIYKARVRNGVSCLEVIWK 421

  Fly  1117 --------------------------QLAIDKMSGKID-ETPEKPKKVTRTRRAKAAPPT--DDD 1152
                                      .||..|:..:.. |..:..:|.|:.::.|....|  |..
Zfish   422 TPEHYVFVEGCEEQAEVRTVEEEALFSLAFPKILQEFQRERNQAQEKKTKKKKPKVKKETLADSH 486

  Fly  1153 LAIADVATKAARPKRGKRKAAPESVVLDGELPSTSQSIPKPEKCPRIPSSVEVIP 1207
            .|::|:.::.             ::..|.::.|::|:.|:|:..|.....|:..|
Zfish   487 DAVSDLFSQM-------------TLNTDPQVVSSAQNPPQPDLPPYPGIQVQTPP 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mus201NP_001027230.1 rad2 1..1122 CDD:273166 80/355 (23%)
PIN_XPG 1..>121 CDD:189038
PIN_XPG <814..1084 CDD:189038 71/283 (25%)
H3TH_XPG 940..1045 CDD:188624 32/161 (20%)
gen1XP_009298211.1 PIN_SF 1..197 CDD:326356 29/76 (38%)
H3TH_StructSpec-5'-nucleases 199..340 CDD:328895 32/159 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094524at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.