DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33688 and CG14455

DIOPT Version :9

Sequence 1:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster


Alignment Length:115 Identity:21/115 - (18%)
Similarity:49/115 - (42%) Gaps:26/115 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KYIDIYVNL---------------HQQVVNNVTVIKL-MRHNNGYKPFFVDVTIDVCKFLK---- 95
            |::|:.|:|               ||.:.:...|:.. :..:.|.....::.|::.||.:|    
  Fly    43 KFLDLKVDLQNDSGESNLSIDIKTHQDIEDVQLVVDFGLETDKGNYSTLINRTLNFCKLMKQRNS 107

  Fly    96 DPRQSIIKKLYDIYKNNSNINHTCPYKDVVIVHHLWTGNLESDFM-KYLP 144
            ||   :::.:|:....:..:...||.:..  .:.|...|::.:.: .:||
  Fly   108 DP---LVRAIYEDLLKHGTLFKECPIRSG--TYSLTNYNVDEEMLPSFLP 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33688NP_001027131.1 DUF1091 72..152 CDD:284008 14/79 (18%)
CG14455NP_649402.2 DM8 87..179 CDD:214778 13/71 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.