DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33688 and CG13250

DIOPT Version :9

Sequence 1:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster


Alignment Length:144 Identity:23/144 - (15%)
Similarity:55/144 - (38%) Gaps:21/144 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LATVFNHVTFTNLKCGIRGEKIYYFEKC-FIKAVNRTHKYIDIYVNLHQQVVN---NVTVIKLMR 74
            |||....:.:.::.|.:.........|| .::...:...:::.::.|.:.|..   .::|.::..
  Fly    26 LATRDFDIRWRDINCSVIDPTTAEIFKCDIVEMPKKQGNFLNTFLLLRRSVTKMWVELSVGQIAN 90

  Fly    75 HNNGYKPFFVDVTIDVCKFLKDPRQS-----IIKKLYDIYKNNSNINHTCPYKDVVIVHHLWTGN 134
            ..:........:.:|.|..::...:|     ::.||.    .:.|....||    ::.:..:|..
  Fly    91 RKDRPVQQLFKIRVDGCHLIEFRSKSRILNAVLHKLL----QSGNYPDACP----LLANVNYTST 147

  Fly   135 ---LESD-FMKYLP 144
               |..| |..|:|
  Fly   148 RFALNPDHFPAYMP 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33688NP_001027131.1 DUF1091 72..152 CDD:284008 14/82 (17%)
CG13250NP_649245.1 DM8 95..181 CDD:214778 14/75 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.