DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33688 and CG12849

DIOPT Version :9

Sequence 1:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_611969.2 Gene:CG12849 / 37971 FlyBaseID:FBgn0035068 Length:172 Species:Drosophila melanogaster


Alignment Length:168 Identity:50/168 - (29%)
Similarity:84/168 - (50%) Gaps:4/168 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILIILGYLATVFNHVTFTNLKCGIRGEKIYYFEKCFIKAVNRTHKYIDIYVNLHQQVVNNV-TVI 70
            :||.:..:| :..|..|.|:.|.:|......||.|::|:||||:||:.:...:.:..|:|. |..
  Fly     8 LLIFMSPMA-IRGHFEFNNVVCLVRDRMFMDFEYCYLKSVNRTYKYLSLKTKMFRLPVDNCETRF 71

  Fly    71 KLMRHNNGYKPFFVDVTIDVCKFLKDPRQSIIKKLYDIYKNNSNINHTCPYKDVVIVHHLWTGNL 135
            :|....|....:..|..:|.|||::|.:..|...:|..:...||:||||||...:::..|...:|
  Fly    72 QLRMRENRRVLYNFDFKVDSCKFMRDRKHVIANWVYQTFGPYSNLNHTCPYDHDIVLDKLPVQHL 136

  Fly   136 ESDFMKYLPLIDGDYAIYTEWSVYNVARAFIDVYIRVS 173
            .......:|  ||.|.:.:.|.|..:.|..:.:|...|
  Fly   137 NKLVQSIIP--DGRYMMNSTWMVAGIPRTDVILYFTKS 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33688NP_001027131.1 DUF1091 72..152 CDD:284008 24/79 (30%)
CG12849NP_611969.2 DM8 80..172 CDD:214778 26/93 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.