DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33688 and CG33919

DIOPT Version :9

Sequence 1:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster


Alignment Length:169 Identity:42/169 - (24%)
Similarity:76/169 - (44%) Gaps:41/169 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LILIILGYLATVF-NHVTFTNLKCGIRGEKIYYFEK--------------CFIKAVNRTHKYID- 54
            |:|::|  |...| ..:|.|.|        :|..:|              |.:||:|.....:: 
  Fly     3 LVLVVL--LGCCFIGQLTNTQL--------VYKLKKIECLVNRTRVSNVSCHVKAINWNLAVVNM 57

  Fly    55 ---IYVNLHQQVVNNVTVIKLMRHNNGYKPFFVDVTIDVCKFLKDPRQSIIKK---LYDIYKNNS 113
               :.|.||..::......|  .::|.||||.|||.|.:|:.::  |::.|..   ::.::|..:
  Fly    58 DCFMIVPLHNPIIRMQVFTK--DYSNQYKPFLVDVKIRICEVIE--RRNFIPYGVIMWKLFKRYT 118

  Fly   114 NINHTCPYKDVVIVHHLWTGNLESDFMKYLPLIDGDYAI 152
            |:||:||:...:|..   .|.|::..:.  |...|.|.:
  Fly   119 NVNHSCPFSGHLIAR---DGFLDTSLLP--PFPQGFYQV 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33688NP_001027131.1 DUF1091 72..152 CDD:284008 24/82 (29%)
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 25/90 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.