DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33688 and CG33640

DIOPT Version :10

Sequence 1:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster


Alignment Length:108 Identity:23/108 - (21%)
Similarity:47/108 - (43%) Gaps:12/108 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NHVTFTNLKCGIRGEKIYYFEKCFIKA-VNRTHKYIDIYVNLHQQVVNNVTVIKLMRHNNGYKP- 81
            :|.|||     :....::..:...::. .||::....:.:|   ::||::|:...|......:| 
  Fly    27 DHFTFT-----VDDRDLFLSQSAVVEQDGNRSYLSGHMMIN---RLVNDLTLTSSMDITRPQRPE 83

  Fly    82 -FFVDVTIDVCKFLKDP-RQSIIKKLYDIYKNNSNINHTCPYK 122
             ...:|.::.|..|.:. :...|:.||:.|....|....||.|
  Fly    84 LRLYNVQLNFCSVLNNGYKNKFIRMLYNNYAQFLNTKPKCPLK 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33688NP_001027131.1 DUF1091 72..152 CDD:461928 13/54 (24%)
CG33640NP_001027255.2 DUF1091 73..154 CDD:461928 13/54 (24%)

Return to query results.
Submit another query.