DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33688 and CG33690

DIOPT Version :9

Sequence 1:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001368948.1 Gene:CG33690 / 3772513 FlyBaseID:FBgn0053690 Length:176 Species:Drosophila melanogaster


Alignment Length:175 Identity:75/175 - (42%)
Similarity:110/175 - (62%) Gaps:1/175 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRVFFLILIILGYLATVFNHVTFTNLKCGIRGEKIYYFEKCFIKAVNRTHKYIDIYVNLHQ-QVV 64
            |..:.|:..:|......|.|||||||.|.........|..|.|||||||||||.||..|:| .:|
  Fly     1 MSKWLLVKFLLTLPMICFCHVTFTNLNCSSYNLDFMSFPTCRIKAVNRTHKYISIYAKLNQVPIV 65

  Fly    65 NNVTVIKLMRHNNGYKPFFVDVTIDVCKFLKDPRQSIIKKLYDIYKNNSNINHTCPYKDVVIVHH 129
            :....|:..|.::|||||..|::.|.|||:|..:..::|..|..::.|:||||||||...:||..
  Fly    66 DARVTIQFRRFDSGYKPFLYDLSYDGCKFMKTQKNVLVKTFYRTFQRNTNINHTCPYDHDLIVDK 130

  Fly   130 LWTGNLESDFMKYLPLIDGDYAIYTEWSVYNVARAFIDVYIRVSN 174
            |:|||||.:|.:::.:.:|||||||:|:...::||.:.:|:::.|
  Fly   131 LFTGNLEEEFGRFIIIPNGDYAIYTDWATNKISRASVKIYLKILN 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33688NP_001027131.1 DUF1091 72..152 CDD:284008 35/79 (44%)
CG33690NP_001368948.1 DUF1091 73..153 CDD:399471 35/79 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D111146at33392
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.