DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33688 and CG33700

DIOPT Version :10

Sequence 1:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001027121.3 Gene:CG33700 / 3772390 FlyBaseID:FBgn0053700 Length:175 Species:Drosophila melanogaster


Alignment Length:150 Identity:42/150 - (28%)
Similarity:78/150 - (52%) Gaps:7/150 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 NLKCGIRGEKIYYFEKCFIKAVNRTHKYIDIYVNLHQQVVNNVTV-IKLMRHNNGYKPFFVDVTI 88
            |:.|......|..|.:|.:|.:.|......:...|:...:.:|.: :.|.:.:|||:||..:.|:
  Fly    27 NVICESFDNAITNFSRCEMKFIRRGVAAFYMVWKLYNVPIKSVDINVALYKKSNGYRPFLFNQTL 91

  Fly    89 DVCKFLKDPR-QSIIKKLYDIYKNNSNINHTCPY-KDVVIVHHLWTGNLESDFMKYLPLIDGDYA 151
            |.|.::::|| ..:|..::.::...|||||:||| .|::|...::..|    .:|.||:.:|||.
  Fly    92 DFCYYMRNPRAHPLIYMMHKVFMQASNINHSCPYDHDLIINEFIYKKN----DLKDLPIPNGDYM 152

  Fly   152 IYTEWSVYNVARAFIDVYIR 171
            |..:.:.....|..|.:|.:
  Fly   153 IRVKVAFDKEYRTSIKIYAK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33688NP_001027131.1 DUF1091 72..152 CDD:461928 29/81 (36%)
CG33700NP_001027121.3 DUF1091 71..153 CDD:461928 29/85 (34%)

Return to query results.
Submit another query.