DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33688 and CG33687

DIOPT Version :9

Sequence 1:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001027130.2 Gene:CG33687 / 3772322 FlyBaseID:FBgn0053687 Length:169 Species:Drosophila melanogaster


Alignment Length:161 Identity:75/161 - (46%)
Similarity:110/161 - (68%) Gaps:6/161 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NHVTFTNLKCGIRGEKIYYFEKCFIKAVNRTHKYIDIYVNLHQQVVNNVTVIKL--MRHNNGYKP 81
            :|::||||||.:.......||.|.|||||||||||||.:.|:...:||: :|||  .|:.|||:|
  Fly    10 SHLSFTNLKCEMIDRTFGNFEMCRIKAVNRTHKYIDINLKLYILPINNI-MIKLDSKRYTNGYRP 73

  Fly    82 FFVDVTIDVCKFLKDPRQS---IIKKLYDIYKNNSNINHTCPYKDVVIVHHLWTGNLESDFMKYL 143
            ||:.:|.|.||:||:|.|.   .:|:::..:.|.||:||||||.:.:.|:..||||||..|::||
  Fly    74 FFMSLTFDFCKYLKNPNQRSMIFLKEIHSTFINASNLNHTCPYNNDITVNKFWTGNLERAFLRYL 138

  Fly   144 PLIDGDYAIYTEWSVYNVARAFIDVYIRVSN 174
            |:.:|||||::.|...||.|..::.:.::.|
  Fly   139 PVPNGDYAIFSTWYSSNVPRLLVNTFFQIKN 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33688NP_001027131.1 DUF1091 72..152 CDD:284008 40/84 (48%)
CG33687NP_001027130.2 DUF1091 64..147 CDD:284008 39/82 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446122
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.