DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33688 and CG33927

DIOPT Version :9

Sequence 1:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster


Alignment Length:167 Identity:46/167 - (27%)
Similarity:81/167 - (48%) Gaps:28/167 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFFLILIILGYL-ATVFNHVTFTNLKCGIRGEKIYYFEKCFIKAVNRTHKYIDIYVNLHQQVVNN 66
            :||.|.:.||.: |:.|.   |||..|....|......:|.:||:.|....:..          |
  Fly    12 LFFRIALELGSINASRFK---FTNFVCDSVNETWLAVHQCRLKAIRRGTTTLSF----------N 63

  Fly    67 VTVIK----------LMRHNNGYKPFFVDVTIDVCKFLKDPRQSIIKKLYDIYKNNSNINHTCPY 121
            .||:|          :.:..||:||:..::|.|.|:||:.|.::.:..::::.|:.||:|.||||
  Fly    64 GTVLKTISKFRVHGQIFKRANGFKPWLYNITFDGCRFLRKPYEAPVIIVFNLLKSFSNLNFTCPY 128

  Fly   122 KDVVIVHHLWTGNLESDFMKYLPLIDGDYAIYTEWSV 158
            ...|   |:...::..:.:. :||..|:|.|..:|.:
  Fly   129 MGPV---HIMGLHIIGEQIP-VPLPTGEYLIQIKWYI 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33688NP_001027131.1 DUF1091 72..152 CDD:284008 24/79 (30%)
CG33927NP_001027147.1 DUF1091 75..155 CDD:284008 24/83 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.