DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33688 and CG33768

DIOPT Version :9

Sequence 1:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001027142.2 Gene:CG33768 / 3771840 FlyBaseID:FBgn0053768 Length:175 Species:Drosophila melanogaster


Alignment Length:152 Identity:38/152 - (25%)
Similarity:65/152 - (42%) Gaps:18/152 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILIILGYLATVFNHVTFTNLKCGIRGEK-IYYFEKCFIKAVNRT-HKYIDIYVNLHQQVVNNVTV 69
            :|:::.....|.:.||...::|    || ..:|....:.:||.| :..|::...|......:|.|
  Fly     7 VLMVIFVSQAVSSSVTLNRVQC----EKNAKFFATLNVTSVNSTIYADIELLQALKAGFRGHVDV 67

  Fly    70 IKLMRHNNGYK-PFFVDVTIDVCKFLKDPRQSIIKKLYDIYKNNSNINHTCPYKDVVIVHHLWTG 133
              .:|.:|..| ...|....|.|:.|...:.|:.::.......|||....||   |...|:...|
  Fly    68 --QLRLSNAKKFQSLVQADTDYCELLSTLKDSLFRRWIKSVSKNSNFMENCP---VPAGHYYLKG 127

  Fly   134 -NLESDFMKYLP--LIDGDYAI 152
             ::|   |..:|  |:.|||.:
  Fly   128 WHVE---MGLVPSYLLSGDYLL 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33688NP_001027131.1 DUF1091 72..152 CDD:284008 23/83 (28%)
CG33768NP_001027142.2 DM8 76..167 CDD:214778 21/77 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.