DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33688 and CG33703

DIOPT Version :9

Sequence 1:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001027119.1 Gene:CG33703 / 3771760 FlyBaseID:FBgn0053703 Length:181 Species:Drosophila melanogaster


Alignment Length:163 Identity:38/163 - (23%)
Similarity:75/163 - (46%) Gaps:23/163 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TNLKCGIRGEKIYYFEKCFIKAVNRTHKYIDIYVN---LHQ----QVVNNVTVIKLMRHNNGYKP 81
            :.::|........||:.|  |.|.|.:....:||:   |::    .:|.|:.|.::.: |..:: 
  Fly    27 SKMECRSLDPSFTYFKTC--KVVRRENGRAALYVSEVFLYKDPIDDIVLNLGVFRIAK-NRRFQ- 87

  Fly    82 FFVDVTIDVCKFLKDPRQSIIKKLYDIYKNN----SNINHTCPYKDVVIVHHLWTGNLESDFMKY 142
             |::.|:|.|.|   .||.:....:......    ||:|.|||.:..:..:..   :::.:.:|.
  Fly    88 -FLNETLDYCLF---SRQYLASGFFGFLMTPLLRISNLNATCPLQQNITFNGF---SVDENTIKE 145

  Fly   143 LPLIDGDYAIYTEWSVYNVARAFIDVY-IRVSN 174
            :|:.:|.|..:...|:....|..:.|| .||:|
  Fly   146 IPIPNGVYMFHLRSSLMKKWRTDVKVYATRVNN 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33688NP_001027131.1 DUF1091 72..152 CDD:284008 18/83 (22%)
CG33703NP_001027119.1 DUF1091 73..155 CDD:284008 20/90 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.