DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33688 and CG33477

DIOPT Version :10

Sequence 1:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_995797.1 Gene:CG33477 / 2768726 FlyBaseID:FBgn0053477 Length:198 Species:Drosophila melanogaster


Alignment Length:181 Identity:40/181 - (22%)
Similarity:65/181 - (35%) Gaps:62/181 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFFLILIILGYLATVFNHVTFTNLKCGI-------------RGEKIYYFE----KCFIKAVNRTH 50
            :|:|.|  .|.|..|..|...:.:...:             ||...|..|    :|....|...|
  Fly     8 IFYLCL--FGLLFFVEEHEVISVICLNLVKYLTIPQPIAVQRGNAEYSLESLDTRCDHDFVEYFH 70

  Fly    51 KYIDIYVNLHQQVVNNVTVIKLMRHNNGYKPFFVDVTIDV---------------CKFLKDPRQS 100
            :..|      .:::....|:||.      ..|.:::||.|               |:||.:|   
  Fly    71 RVPD------SKILYTFRVVKLA------PAFTINITIKVLKTHRIMYKIENFKGCEFLNNP--- 120

  Fly   101 IIKKLY-DIYK----NNSNINHTCPYKDVVIVHHLWTGNLESDFMKYLPLI 146
            :|.|:: :.||    |.|...  ||.|.  .|::|.|..:    |..:|.:
  Fly   121 VIFKMFGESYKTLVVNGSYFK--CPIKP--NVYYLKTDGI----MSMIPSV 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33688NP_001027131.1 DUF1091 72..152 CDD:461928 23/95 (24%)
CG33477NP_995797.1 DUF1091 100..171 CDD:461928 18/75 (24%)

Return to query results.
Submit another query.