DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNApol-gamma35 and Y66D12A.7

DIOPT Version :9

Sequence 1:NP_001027262.1 Gene:DNApol-gamma35 / 3772064 FlyBaseID:FBgn0004407 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_499495.1 Gene:Y66D12A.7 / 176590 WormBaseID:WBGene00013433 Length:175 Species:Caenorhabditis elegans


Alignment Length:68 Identity:15/68 - (22%)
Similarity:32/68 - (47%) Gaps:6/68 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 DSEL-SADLSDLCQHLKHVLNH----AGLRLSEGDGIRTTKNASHLAEHLLETDMLGI-PYTLVI 323
            ||:: .:.||.:.|....::||    :.:|......:...:::..:|:.|...|:.|: |...|.
 Worm    34 DSKIQESQLSPMPQIDAKLINHLERLSLVRFDSEQAVANLRSSIRVAKRLELVDVEGVEPMHTVW 98

  Fly   324 NEQ 326
            .:|
 Worm    99 EDQ 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNApol-gamma35NP_001027262.1 Pol_gamma_b_Cterm 228..361 CDD:239106 15/68 (22%)
Y66D12A.7NP_499495.1 gatC 46..134 CDD:178810 11/56 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4247
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.