powered by:
Protein Alignment DNApol-gamma35 and Y66D12A.7
DIOPT Version :9
Sequence 1: | NP_001027262.1 |
Gene: | DNApol-gamma35 / 3772064 |
FlyBaseID: | FBgn0004407 |
Length: | 361 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_499495.1 |
Gene: | Y66D12A.7 / 176590 |
WormBaseID: | WBGene00013433 |
Length: | 175 |
Species: | Caenorhabditis elegans |
Alignment Length: | 68 |
Identity: | 15/68 - (22%) |
Similarity: | 32/68 - (47%) |
Gaps: | 6/68 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 265 DSEL-SADLSDLCQHLKHVLNH----AGLRLSEGDGIRTTKNASHLAEHLLETDMLGI-PYTLVI 323
||:: .:.||.:.|....::|| :.:|......:...:::..:|:.|...|:.|: |...|.
Worm 34 DSKIQESQLSPMPQIDAKLINHLERLSLVRFDSEQAVANLRSSIRVAKRLELVDVEGVEPMHTVW 98
Fly 324 NEQ 326
.:|
Worm 99 EDQ 101
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4247 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.