DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33902 and HTB1

DIOPT Version :9

Sequence 1:NP_001027300.1 Gene:His2B:CG33902 / 3772058 FlyBaseID:FBgn0053902 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_010510.3 Gene:HTB1 / 851810 SGDID:S000002632 Length:131 Species:Saccharomyces cerevisiae


Alignment Length:121 Identity:89/121 - (73%)
Similarity:104/121 - (85%) Gaps:2/121 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KTSGKA-AKKAGKAQKNITKTDKKKKRK-RKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVND 66
            |.:.|| |:|...|:|..|.||.||:.| |||:|:.||||||||.|||||||.|:|||:||||||
Yeast     8 KPASKAPAEKKPAAKKTSTSTDGKKRSKARKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVND 72

  Fly    67 IFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 122
            ||||||.|||:||.|||:|||::|||||||||:||||||||||||||:|||||:||
Yeast    73 IFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSS 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33902NP_001027300.1 H2B 33..121 CDD:197718 72/87 (83%)
HTB1NP_010510.3 H2B 31..127 CDD:197718 77/95 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345551
Domainoid 1 1.000 125 1.000 Domainoid score I1193
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I1022
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53922
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 1 1.000 - - otm46578
orthoMCL 1 0.900 - - OOG6_100082
Panther 1 1.100 - - LDO PTHR23428
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2558
SonicParanoid 1 1.000 - - X77
TreeFam 00.000 Not matched by this tool.
1312.830

Return to query results.
Submit another query.