DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33902 and H2bc14

DIOPT Version :9

Sequence 1:NP_001027300.1 Gene:His2B:CG33902 / 3772058 FlyBaseID:FBgn0053902 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_835507.1 Gene:H2bc14 / 319186 MGIID:2448404 Length:126 Species:Mus musculus


Alignment Length:129 Identity:103/129 - (79%)
Similarity:107/129 - (82%) Gaps:9/129 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPPKTSGKAAKKAG------KAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSI 59
            ||..|....|.|.|      ||||   |..||:||.|||||::|:||||||||||||||||||.|
Mouse     1 MPEPTKSAPAPKKGSKKAVTKAQK---KDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGI 62

  Fly    60 MNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123
            |||||||||||||.||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse    63 MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33902NP_001027300.1 H2B 33..121 CDD:197718 82/87 (94%)
H2bc14NP_835507.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36 16/37 (43%)
H2B 28..124 CDD:197718 88/95 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 143 1.000 Domainoid score I4621
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I3859
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53922
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 1 1.000 - - otm42638
orthoMCL 1 0.900 - - OOG6_100082
Panther 1 1.100 - - O PTHR23428
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2558
SonicParanoid 1 1.000 - - X77
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.000

Return to query results.
Submit another query.