powered by:
Protein Alignment His2B:CG33902 and his-39
DIOPT Version :9
Sequence 1: | NP_001027300.1 |
Gene: | His2B:CG33902 / 3772058 |
FlyBaseID: | FBgn0053902 |
Length: | 123 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_505201.3 |
Gene: | his-39 / 191681 |
WormBaseID: | WBGene00001913 |
Length: | 67 |
Species: | Caenorhabditis elegans |
Alignment Length: | 67 |
Identity: | 62/67 - (92%) |
Similarity: | 66/67 - (98%) |
Gaps: | 0/67 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 57 MSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121
||||||||||:||||||||||||||||||||:||||||||||:|||||||:||||||.|||||||
Worm 1 MSIMNSFVNDVFERIAAEASRLAHYNKRSTISSREIQTAVRLILPGELAKNAVSEGTNAVTKYTS 65
Fly 122 SK 123
||
Worm 66 SK 67
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
His2B:CG33902 | NP_001027300.1 |
H2B |
33..121 |
CDD:197718 |
58/63 (92%) |
his-39 | NP_505201.3 |
H2B |
<1..66 |
CDD:355063 |
59/64 (92%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160165100 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1744 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000065 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.740 |
|
Return to query results.
Submit another query.