DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33902 and his-39

DIOPT Version :9

Sequence 1:NP_001027300.1 Gene:His2B:CG33902 / 3772058 FlyBaseID:FBgn0053902 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_505201.3 Gene:his-39 / 191681 WormBaseID:WBGene00001913 Length:67 Species:Caenorhabditis elegans


Alignment Length:67 Identity:62/67 - (92%)
Similarity:66/67 - (98%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 MSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121
            ||||||||||:||||||||||||||||||||:||||||||||:|||||||:||||||.|||||||
 Worm     1 MSIMNSFVNDVFERIAAEASRLAHYNKRSTISSREIQTAVRLILPGELAKNAVSEGTNAVTKYTS 65

  Fly   122 SK 123
            ||
 Worm    66 SK 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33902NP_001027300.1 H2B 33..121 CDD:197718 58/63 (92%)
his-39NP_505201.3 H2B <1..66 CDD:355063 59/64 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165100
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.