DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33902 and zgc:173585

DIOPT Version :9

Sequence 1:NP_001027300.1 Gene:His2B:CG33902 / 3772058 FlyBaseID:FBgn0053902 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_001096102.1 Gene:zgc:173585 / 100124605 ZFINID:ZDB-GENE-070822-26 Length:124 Species:Danio rerio


Alignment Length:125 Identity:102/125 - (81%)
Similarity:108/125 - (86%) Gaps:6/125 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PKTSGKAAKKAGKAQKNITKT----DKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSF 63
            |:.:..|.||..|  |.:|||    .||:||.||||||||:||||||||||||||||||.|||||
Zfish     2 PEPAKVAPKKGSK--KAVTKTAGKGGKKRKRTRKESYAIYVYKVLKQVHPDTGISSKAMGIMNSF 64

  Fly    64 VNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123
            |||||||||.||||||||||||||:|||||||||||||||||||||||||||||||||||
Zfish    65 VNDIFERIAGEASRLAHYNKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33902NP_001027300.1 H2B 33..121 CDD:197718 83/87 (95%)
zgc:173585NP_001096102.1 H2B 26..122 CDD:197718 89/95 (94%)
Histone <26..100 CDD:278551 67/73 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 143 1.000 Domainoid score I4585
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 193 1.000 Inparanoid score I3832
OMA 1 1.010 - - QHG53922
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 1 1.000 - - otm24418
orthoMCL 1 0.900 - - OOG6_100082
Panther 1 1.100 - - O PTHR23428
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2558
SonicParanoid 1 1.000 - - X77
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.900

Return to query results.
Submit another query.