DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33801 and HIS1-3

DIOPT Version :10

Sequence 1:NP_001027282.1 Gene:His1:CG33801 / 3772056 FlyBaseID:FBgn0053801 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_179396.1 Gene:HIS1-3 / 816317 AraportID:AT2G18050 Length:167 Species:Arabidopsis thaliana


Alignment Length:48 Identity:11/48 - (22%)
Similarity:20/48 - (41%) Gaps:7/48 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PFSSSSAEIKIARTAPFSSSAENKGNRQI-------NGASSSASSCDA 43
            |..|.:|||:........:|:|.|..:::       |....:.|.|.:
plant   307 PLDSLAAEIEGTMRKGIDASSELKSYKRVFETVKAANQVVRARSRCQS 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33801NP_001027282.1 H15 43..130 CDD:238028 0/1 (0%)
HIS1-3NP_179396.1 H15 21..87 CDD:197772
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.