DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33801 and H1f7

DIOPT Version :9

Sequence 1:NP_001027282.1 Gene:His1:CG33801 / 3772056 FlyBaseID:FBgn0053801 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_081580.2 Gene:H1f7 / 70069 MGIID:1917319 Length:398 Species:Mus musculus


Alignment Length:261 Identity:46/261 - (17%)
Similarity:106/261 - (40%) Gaps:53/261 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 AKKASATPSHPPTQQMVDAS---IKNLKEHGGSSLLAIKKYI-TATYKCDAQKLAPFIKKYLKS- 96
            |::|..||:...||.::..|   ::.:..|...:|.|:||.: .|.|:         :::.:.| 
Mouse    24 AERALRTPAKRGTQSVLRVSQLLLRAIAGHQHLTLDALKKELGNAGYE---------VRREISSH 79

  Fly    97 ------AVVNGKLIQTKGKGASGSFKL-SASAKKEK------------------------DPKAK 130
                  .:..|.|::..|..|:|.|:: ..|..:||                        .|:::
Mouse    80 HEGKSTRLEKGTLLRVSGSDAAGYFRVWKISKPREKAGQSRLTLGSHSSGKTVLKSPRPLRPRSR 144

  Fly   131 SKVLSAEKKVQSKKVASKKI---GVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDAK 192
            .|.....::|..:|..:.|.   .|.::.|:...:..:.:|.....::.|:..:...:::|:.:.
Mouse   145 RKAAKKAREVWRRKARALKARSRRVRTRSTSGARSRTRSRASSRATSRATSRARSRARSRAQSSA 209

  Fly   193 KTGIIKSKPAATKAKVTA-----AKPKAVVAKASKAKPAVSAKPKKTVKKASVSATAKKPKAKTT 252
            ::....|..::.|:...:     |:.||.....|:||..|.:|.::..:....:....:.:|...
Mouse   210 RSSARSSAKSSAKSSTRSSAKSWARSKARSRARSRAKDLVRSKAREQAQAREQARARAREQAHAR 274

  Fly   253 A 253
            |
Mouse   275 A 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33801NP_001027282.1 Linker_histone 46..118 CDD:278939 17/83 (20%)
H1f7NP_081580.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..398 23/161 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.