DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33801 and H1f2

DIOPT Version :9

Sequence 1:NP_001027282.1 Gene:His1:CG33801 / 3772056 FlyBaseID:FBgn0053801 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_003751742.1 Gene:H1f2 / 684681 RGDID:1587893 Length:212 Species:Rattus norvegicus


Alignment Length:258 Identity:104/258 - (40%)
Similarity:127/258 - (49%) Gaps:49/258 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKEHGG 65
            ||::|   .|:|.|||||  ||...:|||:.......:|||.    ||..:::..::...||..|
  Rat     1 MSETA---PAAPAAAPPA--EKAPAKKKAAKKPAGMRRKASG----PPVSELITKAVAASKERSG 56

  Fly    66 SSLLAIKKYITAT-YKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKA 129
            .||.|:||.:.|. |  |.:|....||..|||.|..|.|:||||.||||||||:           
  Rat    57 VSLAALKKALAAAGY--DVEKNNSRIKLGLKSLVSKGILVQTKGTGASGSFKLN----------- 108

  Fly   130 KSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDAKKT 194
             .|..|.|.|.::||.|:.|    :||.| ||| ||||.....||.|.|..|..:|||       
  Rat   109 -KKAASGEAKPKAKKAAAAK----AKKPA-GAA-KKPKKATGAATPKKAAKKTPKKAK------- 159

  Fly   195 GIIKSKPAATKAKVTAAKPKAVVAKASKAKPAVSA-KPKKTVKKASVSATAKKPKAKTTAAKK 256
               |...||...||..:..||.|.||.|.|.|..| |||        :|..|..|||..||||
  Rat   160 ---KPAAAAVTKKVAKSPKKAKVTKAKKVKSASKAVKPK--------AAKPKVAKAKKVAAKK 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33801NP_001027282.1 Linker_histone 46..118 CDD:278939 33/72 (46%)
H1f2XP_003751742.1 H15 34..114 CDD:238028 38/97 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10170
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 122 1.000 Inparanoid score I4648
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565299at2759
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.