DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33801 and si:ch211-113a14.24

DIOPT Version :9

Sequence 1:NP_001027282.1 Gene:His1:CG33801 / 3772056 FlyBaseID:FBgn0053801 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_689758.1 Gene:si:ch211-113a14.24 / 573073 ZFINID:ZDB-GENE-121214-122 Length:199 Species:Danio rerio


Alignment Length:226 Identity:92/226 - (40%)
Similarity:116/226 - (51%) Gaps:37/226 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKEHGGSSLLAIKKYITA- 77
            |||||...||        .|.:|.|||.     |..:.::..::...||..|.||.|:||.::| 
Zfish     7 AAPPAKAPKK--------KAASKPKKAG-----PNVRDLIVKTVTASKERHGVSLAALKKALSAG 58

  Fly    78 TYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKAKSKVLSAEKKVQS 142
            .|  |.:|....:|..:|:.|.||.|:||||.||||||||:   ||:.:||              
Zfish    59 GY--DVEKNNSRVKIAVKALVTNGTLVQTKGTGASGSFKLN---KKQAEPK-------------- 104

  Fly   143 KKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEK-AKAKDAKKTGIIKSKPAATKA 206
            ||.|:||..|.:||.|...:.||.| |.|.|.|.|...||.:| |.||.|.|:.....||||.| 
Zfish   105 KKPAAKKTAVKAKKPAAKKSPKKVK-KPAAAKKATKSPKKAKKPAAAKKATKSPKKAKKPAAAK- 167

  Fly   207 KVTAAKPKAVVAKASKAKPAVSAKPKKTVKK 237
            |.|.:..||.|||....||. :|||||...|
Zfish   168 KATKSPKKAKVAKPKTVKPK-AAKPKKAAPK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33801NP_001027282.1 Linker_histone 46..118 CDD:278939 30/72 (42%)
si:ch211-113a14.24XP_689758.1 Linker_histone 27..97 CDD:278939 30/71 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I11086
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I4847
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565299at2759
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.