DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33801 and si:ch73-368j24.11

DIOPT Version :9

Sequence 1:NP_001027282.1 Gene:His1:CG33801 / 3772056 FlyBaseID:FBgn0053801 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_005168858.1 Gene:si:ch73-368j24.11 / 562307 ZFINID:ZDB-GENE-160113-46 Length:205 Species:Danio rerio


Alignment Length:238 Identity:91/238 - (38%)
Similarity:125/238 - (52%) Gaps:39/238 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKEHGG 65
            |:::|.|.:|:|..||         :|||:    :|.||..     |..:.::..::...||..|
Zfish     1 MAETAPAPAATPAKAP---------KKKAA----SKPKKTG-----PNVRDLIVKTVTASKERNG 47

  Fly    66 SSLLAIKKYITA-TYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKA 129
            .||.|:||.::| .|  |.:|....:|..:|:.|.||.|.||||.||||||||:   ||:.:||.
Zfish    48 VSLAALKKALSAGGY--DVEKNNSRVKTAVKALVTNGTLAQTKGTGASGSFKLN---KKQAEPKK 107

  Fly   130 KSKVLSAE-KKVQSKKVASKKIGVSSKK---TAVGAADKKPKAKKAVATKKTAENKKTEKAKAKD 190
            .:|..:|: ||..:||.|:||....:||   |:|..|.|.||..|..|.||..::.|  |||...
Zfish   108 AAKKTAAKAKKPAAKKPAAKKSPKKAKKPAATSVKKATKSPKKAKPAAAKKATKSPK--KAKKPA 170

  Fly   191 AKKTGIIKSKPAATKAKVTAAKPKAVVAKASKAKPAVSAKPKK 233
            |.|      |.|.:..||.|.|||....||:|.|   .|.|||
Zfish   171 AAK------KAAKSPKKVKAVKPKTAKPKAAKPK---KAAPKK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33801NP_001027282.1 Linker_histone 46..118 CDD:278939 30/72 (42%)
si:ch73-368j24.11XP_005168858.1 Linker_histone 29..99 CDD:278939 30/71 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I11086
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I4847
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.