DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33801 and H1-7

DIOPT Version :9

Sequence 1:NP_001027282.1 Gene:His1:CG33801 / 3772056 FlyBaseID:FBgn0053801 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_861453.1 Gene:H1-7 / 341567 HGNCID:24893 Length:255 Species:Homo sapiens


Alignment Length:253 Identity:53/253 - (20%)
Similarity:102/253 - (40%) Gaps:43/253 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SASPVAAPPATVEKKVVQKKASGSAGTK--AKKASATPSHPPTQQMVDAS---IKNLKEHGGSSL 68
            |.:...||..:.|.:       |.:.|:  |:|....||...:..::..|   ::.:..|.|.:|
Human    19 SGAMAEAPGPSGESR-------GHSATQLPAEKTVGGPSRGCSSSVLRVSQLVLQAISTHKGLTL 76

  Fly    69 LAIKKYI-TATYKC---DAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKL---------SAS 120
            .|:||.: .|.|:.   ..:..||       .......|::..|..|:|.|::         ...
Human    77 AALKKELRNAGYEVRRKSGRHEAP-------RGQAKATLLRVSGSDAAGYFRVWKVPKPRRKPGR 134

  Fly   121 AKKEKDPKAKSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEK 185
            |::|:..:|..:..:|.:..:.::...:|  .:.|...|...:.:.|||.....::|...:...|
Human   135 ARQEEGTRAPWRTPAAPRSSRRRRQPLRK--AARKAREVWRRNARAKAKANARARRTRRARPRAK 197

  Fly   186 ----AKAK-DAKKTGIIKSKPAATKAKVTAAKPKAVVAKASKAKP-AVSAKPKKTVKK 237
                |:|| :|..|...:.:..|.|...|   |::...|...:|| ....:|||..::
Human   198 EPPCARAKEEAGATAADEGRGQAVKEDTT---PRSGKDKRRSSKPREEKQEPKKPAQR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33801NP_001027282.1 Linker_histone 46..118 CDD:278939 16/87 (18%)
H1-7NP_861453.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54 10/41 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..255 27/134 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.