DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33801 and H1f0

DIOPT Version :9

Sequence 1:NP_001027282.1 Gene:His1:CG33801 / 3772056 FlyBaseID:FBgn0053801 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_036710.1 Gene:H1f0 / 24437 RGDID:2777 Length:194 Species:Rattus norvegicus


Alignment Length:246 Identity:90/246 - (36%)
Similarity:115/246 - (46%) Gaps:62/246 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKEHGG 65
            |::::.:|   |.|.|                  .:||.|..:..||....|:.|:|:..|...|
  Rat     1 MTENSTST---PAAKP------------------KRAKAAKKSTDHPKYSDMIVAAIQAEKNRAG 44

  Fly    66 SSLLAIKKYITATYK----CDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKD 126
            ||..:|:|||.:.||    .|:|     ||..:|..|..|.|.||||.||||||:|:    |..:
  Rat    45 SSRQSIQKYIKSHYKVGENADSQ-----IKLSIKRLVTTGVLKQTKGVGASGSFRLA----KGDE 100

  Fly   127 PKAKSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKA---KKAVATKKTAENKKTEKAKA 188
            ||........:|:|  ||||:.|.....||.|..|..|||||   |||         ||...|..
  Rat   101 PKRSVAFKKTKKEV--KKVATPKKAAKPKKAASKAPSKKPKATPVKKA---------KKKPAATP 154

  Fly   189 KDAKKTGIIKSKPAATKAKVTAAKPKAVVAKASKAKPAVSAKPKKTVKKAS 239
            |.|||..|:|.||      |.|:|||       |||| |..|.|.:.|:||
  Rat   155 KKAKKPKIVKVKP------VKASKPK-------KAKP-VKPKAKSSAKRAS 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33801NP_001027282.1 Linker_histone 46..118 CDD:278939 33/75 (44%)
H1f0NP_036710.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 8/45 (18%)
Linker_histone 25..96 CDD:278939 33/75 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..194 56/135 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565299at2759
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.