DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33801 and hil-2

DIOPT Version :9

Sequence 1:NP_001027282.1 Gene:His1:CG33801 / 3772056 FlyBaseID:FBgn0053801 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001370852.1 Gene:hil-2 / 177390 WormBaseID:WBGene00001853 Length:191 Species:Caenorhabditis elegans


Alignment Length:255 Identity:92/255 - (36%)
Similarity:113/255 - (44%) Gaps:70/255 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATS---ASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKE 62
            |||..||.:   .:|..||           ||..|..||..||....:|||...||.|:|.:|||
 Worm     1 MSDVTVAETPAVKTPTKAP-----------KAPKSKTTKEPKAKVAAAHPPFINMVTAAISSLKE 54

  Fly    63 HGGSSLLAIKKYITATYKCDAQ--KLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEK 125
            ..|||.:||.|||||.||...|  |:...::..|...|.:..|:|:.|.||||.|:::..|...|
 Worm    55 RKGSSKIAILKYITANYKVGDQLTKINSRLRAALNKGVASKALVQSVGNGASGRFRVAEKAAATK 119

  Fly   126 DPKAKSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKD 190
            .|.||..|                    :||.|.|    :.||||....|||.:..|    |||.
 Worm   120 KPVAKKPV--------------------AKKAATG----EKKAKKTTVAKKTGDKVK----KAKS 156

  Fly   191 AKKTGIIKSKPAATKAKVTAAKPKAVVAKASKAKPAVSAKPKKT-VKKASVSATAKKPKA 249
            .||.    :||||.|           |||:    ||..|.|||. .|||:.      |||
 Worm   157 PKKI----AKPAAKK-----------VAKS----PAKKAAPKKAPAKKAAA------PKA 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33801NP_001027282.1 Linker_histone 46..118 CDD:278939 34/73 (47%)
hil-2NP_001370852.1 H15 35..118 CDD:238028 35/82 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I6615
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I3461
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55300
OrthoDB 1 1.010 - - D1565299at2759
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 1 1.000 - - mtm4774
orthoMCL 1 0.900 - - OOG6_110754
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.