DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33801 and LOC101735136

DIOPT Version :9

Sequence 1:NP_001027282.1 Gene:His1:CG33801 / 3772056 FlyBaseID:FBgn0053801 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_017948254.1 Gene:LOC101735136 / 101735136 -ID:- Length:242 Species:Xenopus tropicalis


Alignment Length:262 Identity:103/262 - (39%)
Similarity:129/262 - (49%) Gaps:27/262 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKEHGG 65
            |:::|....|.|.|.|.|  :||...|||:|:  ||:||    ||.|...:::..::...||..|
 Frog     1 MAEAAETAPAPPPAEPAA--KKKKQSKKAAGA--TKSKK----PSGPSVSELIVKAVSASKERSG 57

  Fly    66 SSLLAIKKYITA-TYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKA 129
            .||.|:||.:.| .|  |.:|....:|..||..|....|:|.||.||||||||:   ||:...|.
 Frog    58 VSLAALKKVLAAGGY--DVEKNNSRLKLALKGLVSKETLVQVKGSGASGSFKLN---KKQLQSKE 117

  Fly   130 KSKVLSAEKKVQSKKVASKKIGVSSKK-TAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDAKK 193
            |    :|....::||.|:||...|.|| ..|.||.|.||.....|.|.....||..|..||.||.
 Frog   118 K----AAPAAAKAKKPAAKKAAKSPKKPKKVSAAAKSPKKVVKKAAKAAKSPKKVAKKAAKAAKS 178

  Fly   194 TGIIKSKPAATKAKVTAAKPKAVVAKASKAKPA-VSAKPKKTVKKASVSATAKKP---KAKTTAA 254
            ...:..|  |.||..:..||||..||.....|| .|.|||  ..|:...|.|.||   |||..|.
 Frog   179 PKKVAKK--AAKAAKSPIKPKAAKAKKVAKSPAKKSVKPK--AAKSPAKAKAAKPKVAKAKKAAP 239

  Fly   255 KK 256
            ||
 Frog   240 KK 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33801NP_001027282.1 Linker_histone 46..118 CDD:278939 28/72 (39%)
LOC101735136XP_017948254.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 107 1.000 Inparanoid score I4781
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565299at2759
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.