DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33775 and CG14518

DIOPT Version :9

Sequence 1:NP_001027410.1 Gene:CG33775 / 3772054 FlyBaseID:FBgn0053775 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:178 Identity:52/178 - (29%)
Similarity:88/178 - (49%) Gaps:11/178 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RLILVTAAILCSLSLGSECRSK-SRFINMQCESYNESYAVFEKCKLNLLGRGRVGADMYLKLFQT 71
            :::||...:..||....:|.:. .:..|..||:||:|:..|..|:|..:.|.:|..::...|.. 
  Fly     2 KIVLVIWMLAHSLQPPYQCDAVIFKMTNAVCETYNKSWVEFGLCRLRAVSRNKVCLNVDANLLH- 65

  Fly    72 PVENCWINWAMYRRYNGFQPFLYNVSTDLCQLLGNPNAISFQGLVINAIKKGSNLNHSCPYNHDI 136
            ||.:..:...:.:|.||::|:||:||.|.||.:...|....: :|....|:.|.:||:|||....
  Fly    66 PVHDVIVKARLLKRANGYKPWLYSVSFDGCQFIRRRNNALIR-IVWELFKEYSTINHTCPYVGLQ 129

  Fly   137 IVDNMEFSDDFLKTLPLPQGVYKIQLRFATYKVWRVQVA-----VFIE 179
            .|.|.....:.|.| |:|.|.|.:.:.:...|  :.|.|     .|:|
  Fly   130 QVKNFYLRSEKLPT-PIPTGEYLLMIDWVFNK--KPQAATNVYFTFVE 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33775NP_001027410.1 DUF1091 78..160 CDD:284008 28/81 (35%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 28/93 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472569
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.840

Return to query results.
Submit another query.