powered by:
Protein Alignment CG33775 and CG14456
DIOPT Version :9
Sequence 1: | NP_001027410.1 |
Gene: | CG33775 / 3772054 |
FlyBaseID: | FBgn0053775 |
Length: | 182 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001137998.1 |
Gene: | CG14456 / 40481 |
FlyBaseID: | FBgn0037176 |
Length: | 213 |
Species: | Drosophila melanogaster |
Alignment Length: | 37 |
Identity: | 10/37 - (27%) |
Similarity: | 19/37 - (51%) |
Gaps: | 0/37 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 95 NVSTDLCQLLGNPNAISFQGLVINAIKKGSNLNHSCP 131
|.:.::|::||..|.......|...|::..|:..:||
Fly 88 NTTLNVCRILGFANKSPVGRFVHGFIREFGNIVETCP 124
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33775 | NP_001027410.1 |
DUF1091 |
78..160 |
CDD:284008 |
10/37 (27%) |
CG14456 | NP_001137998.1 |
DM8 |
82..189 |
CDD:214778 |
10/37 (27%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45448149 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR20898 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.