DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33775 and CG33919

DIOPT Version :9

Sequence 1:NP_001027410.1 Gene:CG33775 / 3772054 FlyBaseID:FBgn0053775 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster


Alignment Length:169 Identity:41/169 - (24%)
Similarity:80/169 - (47%) Gaps:35/169 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAELASSRLILVTAAILCSLSLGSECRSKSRFINMQC--ESYNESYAVFEKCKLNLLGRGRVGAD 63
            :.:|.:::|:.....|.|.:       :::|..|:.|  ::.|.:.||             |..|
  Fly    14 IGQLTNTQLVYKLKKIECLV-------NRTRVSNVSCHVKAINWNLAV-------------VNMD 58

  Fly    64 MYLKLFQTPVENCWINWAMYRR--YNGFQPFLYNVSTDLCQLLGNPNAISFQGLVINAIKKGSNL 126
            .::.:   |:.|..|...::.:  .|.::|||.:|...:|:::...|.|.:..::....|:.:|:
  Fly    59 CFMIV---PLHNPIIRMQVFTKDYSNQYKPFLVDVKIRICEVIERRNFIPYGVIMWKLFKRYTNV 120

  Fly   127 NHSCPYNHDIIVDNMEFSDDFLKTL---PLPQGVYKIQL 162
            |||||::..:|.     .|.||.|.   |.|||.|::.|
  Fly   121 NHSCPFSGHLIA-----RDGFLDTSLLPPFPQGFYQVSL 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33775NP_001027410.1 DUF1091 78..160 CDD:284008 26/86 (30%)
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 26/86 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472571
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
54.840

Return to query results.
Submit another query.