DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33775 and CG33923

DIOPT Version :9

Sequence 1:NP_001027410.1 Gene:CG33775 / 3772054 FlyBaseID:FBgn0053775 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster


Alignment Length:152 Identity:53/152 - (34%)
Similarity:81/152 - (53%) Gaps:3/152 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KSRFINMQCESYNESYAVFEKCKLNLLGRGRVGADMYLKLFQTPVENCWINWAMYRRYNGFQPFL 93
            |..|.|::|.:.:..:|.|:.|.|..:.|......:.:||.:||:....||.|:.:|.||::|||
  Fly    23 KVEFANIKCVTLDPEFADFDYCYLKAVSRTYKYLSLRVKLLETPITKIKINVAILQRLNGYKPFL 87

  Fly    94 YNVSTDLCQLLGNPNAISFQGLVINAIKKGSNLNHSCPYNHDIIVDNMEFS---DDFLKTLPLPQ 155
            |||:.|.|:...|..:......:.:..|..||:||||||:|||||:.:..|   ....|.||:|.
  Fly    88 YNVTIDACKFYKNQKSNPIARYLYSFFKDYSNINHSCPYDHDIIVEKLPISHVNTQVTKVLPVPH 152

  Fly   156 GVYKIQLRFATYKVWRVQVAVF 177
            |.|.....:..|.:.|..|.|:
  Fly   153 GDYLFHSNWYAYDINRAIVDVY 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33775NP_001027410.1 DUF1091 78..160 CDD:284008 36/84 (43%)
CG33923NP_001027216.2 DUF1091 72..157 CDD:284008 36/84 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472191
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.940

Return to query results.
Submit another query.