DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33775 and CG33766

DIOPT Version :9

Sequence 1:NP_001027410.1 Gene:CG33775 / 3772054 FlyBaseID:FBgn0053775 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001027140.1 Gene:CG33766 / 3772380 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster


Alignment Length:170 Identity:40/170 - (23%)
Similarity:70/170 - (41%) Gaps:37/170 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AAILCSLSLGSEC-------RSKSRFINMQCESYNESY----AVFEK-CKLNL---LGRGRV-GA 62
            |.::.|:|:...|       .:|...:..||.::|.||    .:|.| .::|:   |.|..| |.
  Fly     2 AKVVLSISMSLICLIIVPIPTNKILLLESQCGNFNRSYFSNFTMFVKNSQMNMEFFLLRVLVPGV 66

  Fly    63 DMYLKLFQTPVENCWINWAMYRRYNGFQPFLYNVSTDLCQLLGNPNAISFQGLVINAIKKGSNLN 127
            .|.::.|          .:|...| |||. ::..:.|:|.||.......|:.........| |..
  Fly    67 TMDIEFF----------ISMQNSY-GFQK-IFQYTLDMCSLLAQRRNNMFKKWFATFFDSG-NFK 118

  Fly   128 HSCPYNHDIIVDNMEFSDDF-LKTLPLPQGVY--KIQLRF 164
            ..||     :..|..:..:: ..||.:|:.:|  |.:::|
  Fly   119 KYCP-----VEPNFYYLKNYNYNTLFIPKFLYAGKYRVKF 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33775NP_001027410.1 DUF1091 78..160 CDD:284008 19/84 (23%)
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 22/100 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447829
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.