DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33775 and CG33777

DIOPT Version :9

Sequence 1:NP_001027410.1 Gene:CG33775 / 3772054 FlyBaseID:FBgn0053775 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001027108.1 Gene:CG33777 / 3772311 FlyBaseID:FBgn0053777 Length:172 Species:Drosophila melanogaster


Alignment Length:151 Identity:46/151 - (30%)
Similarity:78/151 - (51%) Gaps:3/151 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RFINMQCESYNESYAVFEKCKLNLLGRGRVGADMYLKLFQTPVENCWINWAMYRRYNGFQPFLYN 95
            :|.|::|.|.:..:|..:.|.|..:.|......:.:.|.|.||....:|.|.::||||::|.|||
  Fly    19 KFTNIKCTSLDPEFAHVDHCYLKSVNRTYKYLSLRVNLLQKPVSRIKVNAATWKRYNGYKPSLYN 83

  Fly    96 VSTDLCQLLGNPNAISFQGLVINAIKKGSNLNHSCPYNHDIIVDNMEFS---DDFLKTLPLPQGV 157
            .:.|.|:.:.||.:......:....|..||:|::||:|.|.||:.:..|   :.....||:|.|.
  Fly    84 FTVDACKFIKNPKSNPVAHYIYRLFKDYSNVNYTCPFNDDAIVEKLPISFVNNQVTSVLPVPSGD 148

  Fly   158 YKIQLRFATYKVWRVQVAVFI 178
            |.....:..|.:.||.:.|::
  Fly   149 YLFSSHWYFYDIKRVTINVYM 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33775NP_001027410.1 DUF1091 78..160 CDD:284008 30/84 (36%)
CG33777NP_001027108.1 DUF1091 72..151 CDD:284008 28/78 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472170
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.940

Return to query results.
Submit another query.