DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33775 and CG33792

DIOPT Version :10

Sequence 1:NP_001027410.1 Gene:CG33775 / 3772054 FlyBaseID:FBgn0053775 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster


Alignment Length:101 Identity:32/101 - (31%)
Similarity:47/101 - (46%) Gaps:22/101 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 NGFQPFLYNVSTDLCQLLGNPNAISF-QGLVINAIKKGSNLNHSCPYNHDIIVDN-------MEF 143
            |.::||......|:||||.|....:| |...|:.:.:.:|:||||||...:.:.|       :|:
  Fly    88 NLYKPFAVKFKFDVCQLLKNKTQSNFLQKYAISHLTEWTNVNHSCPYRVSLCIYNIVKFSQYIEY 152

  Fly   144 SDDFLK-------------TLP-LPQGVYKIQLRFA 165
            ...|||             :|| ||...|||...|:
  Fly   153 IYMFLKGHLIARNFRLDEVSLPILPIQDYKIAFNFS 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33775NP_001027410.1 DUF1091 78..160 CDD:461928 29/94 (31%)
CG33792NP_001027411.2 DUF1091 82..183 CDD:461928 29/94 (31%)

Return to query results.
Submit another query.