DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33775 and CG33767

DIOPT Version :10

Sequence 1:NP_001027410.1 Gene:CG33775 / 3772054 FlyBaseID:FBgn0053775 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001027141.1 Gene:CG33767 / 3772047 FlyBaseID:FBgn0053767 Length:188 Species:Drosophila melanogaster


Alignment Length:76 Identity:14/76 - (18%)
Similarity:32/76 - (42%) Gaps:4/76 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 MYRRYNGFQPFLYNVSTDLCQLLGNPNAISFQGLVINAIKKGSNLNHSCPYNHDIIVDNMEFSDD 146
            ||.|::    :..::|.::.::....:.|....|.|......||.:.:...|..:.:.|.....|
  Fly     3 MYFRHH----YSLDISIEMLKVCTLVSIIFVHKLAITGAAGKSNFSPTYFENFTLEIQNNTLFMD 63

  Fly   147 FLKTLPLPQGV 157
            ...:.|:.:|:
  Fly    64 MTTSKPIHRGL 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33775NP_001027410.1 DUF1091 78..160 CDD:461928 14/76 (18%)
CG33767NP_001027141.1 DM8 90..180 CDD:214778
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.