DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33775 and CG33641

DIOPT Version :9

Sequence 1:NP_001027410.1 Gene:CG33775 / 3772054 FlyBaseID:FBgn0053775 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001027256.1 Gene:CG33641 / 3771970 FlyBaseID:FBgn0053641 Length:181 Species:Drosophila melanogaster


Alignment Length:117 Identity:31/117 - (26%)
Similarity:44/117 - (37%) Gaps:17/117 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VFEKCKLNLL---GRGRVGADMYLK-----LFQTPVENCWINWAMYRRYNGFQPFLYNVSTDLCQ 102
            :|||...||.   .|..|..:|.||     |....:...|...|..:..      ||:|..|.|.
  Fly    40 IFEKMDCNLYQANNRSYVNVEMKLKKEVSDLNVRAIMEFWKPNAQNKMK------LYDVRVDGCL 98

  Fly   103 LLGNPNAISFQGLVINAIKKGSNLNHSCPYNHDIIVDNMEFSDDFLKTLPLP 154
            :|...:........:.:.||.||:..|||:..:.   ..:..|.||....||
  Fly    99 ILRTIHKNKLFYFYVKSFKKHSNVVLSCPFKANF---TYKMDDWFLDEEELP 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33775NP_001027410.1 DUF1091 78..160 CDD:284008 19/77 (25%)
CG33641NP_001027256.1 DUF1091 80..156 CDD:284008 19/77 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.