DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33775 and CG14492

DIOPT Version :9

Sequence 1:NP_001027410.1 Gene:CG33775 / 3772054 FlyBaseID:FBgn0053775 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_611275.2 Gene:CG14492 / 37045 FlyBaseID:FBgn0034283 Length:199 Species:Drosophila melanogaster


Alignment Length:148 Identity:39/148 - (26%)
Similarity:62/148 - (41%) Gaps:9/148 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ECRSKSRF----INMQCESYNESYAVFEK--CKLNLLGRGRVGADMYLKLFQTPVENCWINWAMY 83
            |..:|:.|    .|..|.|.:.|.:|.::  |.::...:.|.. .|...|.|...|:.:....:.
  Fly    25 EAEAKNNFELQTDNFTCSSDDISSSVLKEFTCGISKSTKRRTW-HMEFVLEQPVAEHDFFIKIVL 88

  Fly    84 RRYNGFQPF-LYNVSTDLCQLLGNPNAISFQGLVINAIKKGSNLNHSCPYNHDIIVDNMEFSDDF 147
            .|......| |.||:||.||||.|.|.:....|..|.:::.||....||:..:.......|..| 
  Fly    89 PRRRPLPDFVLLNVTTDGCQLLANRNQVPLMRLGRNIMERFSNFPKQCPFKPNFTYYIRGFRLD- 152

  Fly   148 LKTLPLPQGVYKIQLRFA 165
            |..:|.......:|:.|:
  Fly   153 LNLVPAVDMETPVQIEFS 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33775NP_001027410.1 DUF1091 78..160 CDD:284008 23/82 (28%)
CG14492NP_611275.2 DM8 95..186 CDD:214778 24/77 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.