DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33775 and CG33467

DIOPT Version :9

Sequence 1:NP_001027410.1 Gene:CG33775 / 3772054 FlyBaseID:FBgn0053775 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster


Alignment Length:167 Identity:33/167 - (19%)
Similarity:71/167 - (42%) Gaps:26/167 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAELASSRLILVTAAILCSLSLGSECRSKSRFINMQCESYNESYAVFEKCKLNLLGRGRVGADMY 65
            :..:..|:|:.....:.|.   |::.|.|:...|::..::|.:.               |..|.|
  Fly    14 IGHMTDSQLVYKFTKVECQ---GNQARVKNVSCNVKPINWNTAL---------------VNLDCY 60

  Fly    66 LKLFQTPVENCWINWAMYRR--YNGFQPFLYNVSTDLCQLLGNPNAISFQGLVINAIKKGSNLNH 128
            |..   |:.|..|...::.:  .|.::|||.:.:..||.::...|.:.:..:|....::.:|:. 
  Fly    61 LIY---PLINPTIRVQVFMKDYSNQYKPFLIDATFKLCDVVERKNFLPYAVMVWELFQRFTNVK- 121

  Fly   129 SCPYNHDIIVDNMEFSDDFLKTLPLPQGVYKIQLRFA 165
            ||..:..:...|...:..::.  |.|.|.|:|.:.|:
  Fly   122 SCHISGQLSARNGYLNSSYVP--PFPHGQYQISVMFS 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33775NP_001027410.1 DUF1091 78..160 CDD:284008 17/83 (20%)
CG33467NP_001286440.1 DUF1091 70..151 CDD:284008 17/83 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472562
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.