DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33775 and CG33483

DIOPT Version :9

Sequence 1:NP_001027410.1 Gene:CG33775 / 3772054 FlyBaseID:FBgn0053775 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster


Alignment Length:158 Identity:48/158 - (30%)
Similarity:83/158 - (52%) Gaps:19/158 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FINMQCESYNESYAVFEKCKLNLLGRGRVGADMYLKLFQTPVENCWINWAMYRRYNGFQPFLYNV 96
            |.|::|.|:::::..||.|.|..:.|......:.:.|.:.|:....:|:::.:|:||::|||||:
  Fly    77 FTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLKVNLHKVPITKVKVNFSLLKRFNGYKPFLYNI 141

  Fly    97 STDLCQLLG----NPNAISFQGLVINAIKKGSNLNHSCPYNHDIIVD-------NMEFSDDFLKT 150
            :.|.|:.|.    ||....|.||    .|..||:||:||::||:||:       |.:.:.|    
  Fly   142 TVDACKALRHSKYNPIFSFFYGL----FKHHSNMNHTCPFDHDLIVEKLPTNFMNQKVNGD---- 198

  Fly   151 LPLPQGVYKIQLRFATYKVWRVQVAVFI 178
            :..|.|.|.....:..|.:.|..|..|:
  Fly   199 IKFPHGDYLFHSDWYAYGINRATVDFFL 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33775NP_001027410.1 DUF1091 78..160 CDD:284008 33/92 (36%)
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 33/92 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472156
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.840

Return to query results.
Submit another query.