DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33647 and CG34260

DIOPT Version :9

Sequence 1:NP_001027136.1 Gene:CG33647 / 3772049 FlyBaseID:FBgn0053647 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001262120.1 Gene:CG34260 / 5740551 FlyBaseID:FBgn0085289 Length:178 Species:Drosophila melanogaster


Alignment Length:165 Identity:37/165 - (22%)
Similarity:66/165 - (40%) Gaps:24/165 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LGTLILSSVRAEKEVFMTKIECLNYMPELVRNVSCYLNETSHPTGSIYAEFILTQDVE--DLKGI 76
            ||..|::      :.::..:|||     |||          ..|..:..:|.|.|.:|  |:...
  Fly    30 LGCQIIA------KAYVNSLECL-----LVR----------QRTAVVAVKFSLNQTIEHFDVLAT 73

  Fly    77 YILTFKRGSYVTNFTSSHVDYCQMLSSVENHFLFRMVTTQLRETANFPIQCPLKMNKRYYAKGFT 141
            :.| .|:.....|.....:|.|:.|.|:..:.:...:..:|:..:|.|..||:...|.|..:.:|
  Fly    74 FDL-IKKDKSRMNIADIKIDGCKYLGSMYQNNIVGKLFKRLKSVSNLPDSCPVSKGKLYEIRNYT 137

  Fly   142 VNSKFIPSYMPETNFISDAHLSVKDRKVFRLLIKG 176
            ..|...|...|:..:.....|..:...|..:.|:|
  Fly   138 FISDEFPPGAPQAKWQVRLKLLKRSELVADISIEG 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33647NP_001027136.1 DUF1091 <95..156 CDD:284008 15/60 (25%)
CG34260NP_001262120.1 DUF1091 73..154 CDD:284008 18/81 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FA0X
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.