DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33647 and CG13250

DIOPT Version :9

Sequence 1:NP_001027136.1 Gene:CG33647 / 3772049 FlyBaseID:FBgn0053647 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster


Alignment Length:196 Identity:41/196 - (20%)
Similarity:78/196 - (39%) Gaps:23/196 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VKKLFILVDLILGTLILSSVRA-EKEVFMTKIECLNYMPELVRNVSCYLNETSHPTGSIYAEFIL 66
            ::.|.||..|::..|...|:.. :.::....|.|....|.......|.:.|.....|:....|:|
  Fly     7 LRGLLILCCLVVPILWQPSLATRDFDIRWRDINCSVIDPTTAEIFKCDIVEMPKKQGNFLNTFLL 71

  Fly    67 TQDVEDLKGIYI------LTFKRGSYVTNFTSSHVDYCQMLSSVENHFLFRMVTTQLRETANFPI 125
            .:  ..:..:::      :..::...|.......||.|.::.......:...|..:|.::.|:|.
  Fly    72 LR--RSVTKMWVELSVGQIANRKDRPVQQLFKIRVDGCHLIEFRSKSRILNAVLHKLLQSGNYPD 134

  Fly   126 QCPLKMNKRYYAKGFTVNSKFIPSYMPETNFISDAHLSVKDRKVFRL-----LIKGRF-SRILRR 184
            .|||..|..|.:..|.:|....|:|||:..|        ..:.||:|     ||:... :.::||
  Fly   135 ACPLLANVNYTSTRFALNPDHFPAYMPDMKF--------NTKLVFQLSRNMGLIRASVDAEVMRR 191

  Fly   185 N 185
            :
  Fly   192 S 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33647NP_001027136.1 DUF1091 <95..156 CDD:284008 18/60 (30%)
CG13250NP_649245.1 DM8 95..181 CDD:214778 24/93 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FA0X
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.