DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33647 and CG13561

DIOPT Version :10

Sequence 1:NP_001027136.1 Gene:CG33647 / 3772049 FlyBaseID:FBgn0053647 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster


Alignment Length:102 Identity:20/102 - (19%)
Similarity:40/102 - (39%) Gaps:21/102 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 NVSCYLNETSHPTGSIYAEFILTQDVEDL----------KG---IYILTFKRGS----YVTNFTS 92
            |:.|...:.:..|.|:...:.:.:||.::          ||   :.:...|:.|    ::.|...
  Fly    27 NIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWPKGPVSMRMQLLKKASGYKPFLYNICQ 91

  Fly    93 SHVDYCQMLSSVENHFLFRMVTTQLRETANFPIQCPL 129
            |  |.|:.|.. .||....::.:......|.. :||:
  Fly    92 S--DVCEYLEK-RNHPFINIILSSFGNRTNVN-KCPI 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33647NP_001027136.1 DUF1091 <95..156 CDD:461928 8/35 (23%)
CG13561NP_611830.3 DM8 82..173 CDD:214778 10/47 (21%)

Return to query results.
Submit another query.