DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33647 and CG33795

DIOPT Version :10

Sequence 1:NP_001027136.1 Gene:CG33647 / 3772049 FlyBaseID:FBgn0053647 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster


Alignment Length:139 Identity:29/139 - (20%)
Similarity:52/139 - (37%) Gaps:28/139 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NVKKLFILVDLILGTLILS-SV---------RAEKEVFMTKIECLNYMPELVRNVSCY-LNET-S 54
            ||.|:.:::...|.|..|| ||         .:..:.::|..||  .:..:.||.:.: .|.| .
  Fly     3 NVLKIVVILVTFLLTWRLSYSVTYKLTNVICESRNQSWVTINEC--RLKAVNRNRTVFNFNATIH 65

  Fly    55 HPTGSIYAEFILTQDVEDLKGIYILTFKRGSYVTNFTSSHVDYCQMLSSVENHFLFRMVTTQLRE 119
            |||..:..:             |....:...|.......::|.|:.|....: .|.:|:....:.
  Fly    66 HPTNDVVID-------------YRFLKRENGYKPWLYKKNIDGCRFLRKPYD-MLTKMIYMVFKP 116

  Fly   120 TANFPIQCP 128
            .:|....||
  Fly   117 FSNINHTCP 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33647NP_001027136.1 DUF1091 <95..156 CDD:461928 8/34 (24%)
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 9/50 (18%)

Return to query results.
Submit another query.