DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33647 and CG33725

DIOPT Version :10

Sequence 1:NP_001027136.1 Gene:CG33647 / 3772049 FlyBaseID:FBgn0053647 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster


Alignment Length:130 Identity:25/130 - (19%)
Similarity:43/130 - (33%) Gaps:42/130 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TKIECLNYMPELVRNVS------CYLNETS-------------HPTGSIYAEFILTQDVEDLKGI 76
            |...||:      ||.|      |.|...|             ||..:|.....|.:.....|. 
  Fly    30 TNFACLS------RNQSWFVFHNCRLKAVSREKVLLNFNGTVLHPANNIIVHVKLFKKANGFKP- 87

  Fly    77 YILTFKRGSYVTNFTSSHVDYCQMLSSVENHFLFRMVTTQLRETANFPIQCP---LKMNKRYYAK 138
            ::|..|            :|.|:.:.: ..|...|::....::.:.....||   |::.|.:|.:
  Fly    88 WLLDVK------------LDACRFVRT-NFHPFVRIIFDLFKDFSTINHTCPYVGLQVVKDFYLR 139

  Fly   139  138
              Fly   140  139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33647NP_001027136.1 DUF1091 <95..156 CDD:461928 9/47 (19%)
CG33725NP_001027125.1 DUF1091 74..154 CDD:461928 13/80 (16%)

Return to query results.
Submit another query.