DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33647 and CG33641

DIOPT Version :9

Sequence 1:NP_001027136.1 Gene:CG33647 / 3772049 FlyBaseID:FBgn0053647 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001027256.1 Gene:CG33641 / 3771970 FlyBaseID:FBgn0053641 Length:181 Species:Drosophila melanogaster


Alignment Length:179 Identity:33/179 - (18%)
Similarity:74/179 - (41%) Gaps:9/179 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VKKLFILVDLILGTLILSSVRAEK---EVFMTKIECLNYMPELVRNVSCYLNETSHPTGSIYAEF 64
            :|:|:.:..|.   .::...:.|.   .:|..:......:|::...:.|.|.:.:: ...:..|.
  Fly     1 MKRLYFICGLY---FLMDLAKCENRRLRIFFDEFAIKYKVPDIFEKMDCNLYQANN-RSYVNVEM 61

  Fly    65 ILTQDVEDLKGIYILTFKRGSYVTNFT--SSHVDYCQMLSSVENHFLFRMVTTQLRETANFPIQC 127
            .|.::|.||....|:.|.:.:......  ...||.|.:|.::..:.||.......::.:|..:.|
  Fly    62 KLKKEVSDLNVRAIMEFWKPNAQNKMKLYDVRVDGCLILRTIHKNKLFYFYVKSFKKHSNVVLSC 126

  Fly   128 PLKMNKRYYAKGFTVNSKFIPSYMPETNFISDAHLSVKDRKVFRLLIKG 176
            |.|.|..|....:.::.:.:|.:.|...|.:......:.|.:.|::..|
  Fly   127 PFKANFTYKMDDWFLDEEELPPFAPVGQFRTVTEYFTQQRLIIRVVAHG 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33647NP_001027136.1 DUF1091 <95..156 CDD:284008 14/60 (23%)
CG33641NP_001027256.1 DUF1091 80..156 CDD:284008 14/75 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FA0X
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.